Data Item _entity_poly.pdbx_seq_one_letter_code_can
Browse:
General 
- Item name
- _entity_poly.pdbx_seq_one_letter_code_can
- Category name
- entity_poly
- Attribute name
- pdbx_seq_one_letter_code_can
- Required in PDB entries
- no
- Used in current PDB entries
- Yes, in about 100.0 % of entries
Item Description
Cannonical chemical sequence expressed as string of
one-letter amino acid codes. Modifications are coded
as the parent amino acid where possible.
A for alanine or adenine
B for ambiguous asparagine/aspartic-acid
R for arginine
N for asparagine
D for aspartic-acid
C for cysteine or cystine or cytosine
Q for glutamine
E for glutamic-acid
Z for ambiguous glutamine/glutamic acid
G for glycine or guanine
H for histidine
I for isoleucine
L for leucine
K for lysine
M for methionine
F for phenylalanine
P for proline
S for serine
T for threonine or thymine
W for tryptophan
Y for tyrosine
V for valine
U for uracil
Item Example
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD
Data Type 
- Data type code
- text
- Data type detail
- text item types / multi-line text ...
- Primitive data type code
- char
- Regular expression
- [][ \n\t()_,.;:"&<>/\{}'`~!@#$%?+=*A-Za-z0-9|^-]*
Aliases
| Alias Item Name | Dictionary Name | Dictionary Version |
|---|---|---|
| _entity_poly.ndb_seq_one_letter_code_can | cif_rcsb.dic | 1.1 |