Data Item _entity_poly.ndb_seq_one_letter_code
Browse:
General 
- Item name
- _entity_poly.ndb_seq_one_letter_code
- Category name
- entity_poly
- Attribute name
- ndb_seq_one_letter_code
- Required in PDB entries
- Used in currrent PDB entries
- No
Item Description
Additional Descriptive Information for Depositors
The sequence expressed as string of one-letter amino acid or nucleic acid codes.Letters should not be separated by commas or spaces.
The one-letter code sequence derived from your coordinates is displayed by Pre-Deposition Data Format Check. You may edit this as necessary and copy the result into this sequence data item. Here is the list of one-letter codes: A for alanine or adenine B for ambiguous asparagine/aspartic-acid R for arginine N for asparagine D for aspartic-acid C for cysteine or cystine or cytosine Q for glutamine E for glutamic-acid Z for ambiguous glutamine/glutamic acid G for glycine or guanine H for histidine I for isoleucine L for leucine K for lysine M for methionine F for phenylalanine P for proline S for serine T for threonine or thymine W for tryptophan Y for tyrosine V for valine U for uracil
Item Example
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD
Data Type 
- Data type code
- text
- Data type detail
- text item types / multi-line text ...
- Primitive data type code
- char
- Regular expression
- [][ \n\t()_,.;:"&<>/\{}'`~!@#$%?+=*A-Za-z0-9|^-]*